SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uwga_ (5uwg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013075Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2013076Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2013090Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 2013091Protein automated matches [274417] (1 species)
    not a true protein
  7. 2013092Species Human (Homo sapiens) [TaxId:9606] [274420] (8 PDB entries)
  8. 2292215Domain d5uwga_: 5uwg A: [335516]
    automated match to d5bqcb_
    complexed with nag, pam

Details for d5uwga_

PDB Entry: 5uwg (more details), 2.56 Å

PDB Description: the crystal structure of fz4-crd in complex with palmitoleic acid
PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5uwga_:

Sequence, based on SEQRES records: (download)

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp

Sequence, based on observed residues (ATOM records): (download)

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqnhmcmegp

SCOPe Domain Coordinates for d5uwga_:

Click to download the PDB-style file with coordinates for d5uwga_.
(The format of our PDB-style files is described here.)

Timeline for d5uwga_:

  • d5uwga_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15