Lineage for d5uwga_ (5uwg A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013075Fold a.141: Frizzled cysteine-rich domain [63500] (1 superfamily)
    Core: 3 helices; irregular array; disulfide-rich
  4. 2013076Superfamily a.141.1: Frizzled cysteine-rich domain [63501] (2 families) (S)
    automatically mapped to Pfam PF01392
  5. 2013090Family a.141.1.0: automated matches [274414] (1 protein)
    not a true family
  6. 2013091Protein automated matches [274417] (1 species)
    not a true protein
  7. 2013092Species Human (Homo sapiens) [TaxId:9606] [274420] (8 PDB entries)
  8. 2292215Domain d5uwga_: 5uwg A: [335516]
    automated match to d5bqcb_
    complexed with nag, pam

Details for d5uwga_

PDB Entry: 5uwg (more details), 2.56 Å

PDB Description: the crystal structure of fz4-crd in complex with palmitoleic acid
PDB Compounds: (A:) Frizzled-4

SCOPe Domain Sequences for d5uwga_:

Sequence, based on SEQRES records: (download)

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqndhnhmcmegp

Sequence, based on observed residues (ATOM records): (download)

>d5uwga_ a.141.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcdpirismcqnlgynvtkmpnlvghelqtdaelqlttftpliqygcssqlqfflcsvyv
pmctekinipigpcggmclsvkrrcepvlkefgfawpeslncskfppqnhmcmegp

SCOPe Domain Coordinates for d5uwga_:

Click to download the PDB-style file with coordinates for d5uwga_.
(The format of our PDB-style files is described here.)

Timeline for d5uwga_:

  • d5uwga_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15