Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Dengue virus [TaxId:12637] [335510] (1 PDB entry) |
Domain d5xajb2: 5xaj B:107-214 [335511] Other proteins in same PDB: d5xajb1, d5xajc1 automated match to d1dn0a2 |
PDB Entry: 5xaj (more details), 2.5 Å
SCOPe Domain Sequences for d5xajb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xajb2 b.1.1.2 (B:107-214) automated matches {Dengue virus [TaxId: 12637]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d5xajb2: