Lineage for d5xajb2 (5xaj B:107-214)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (765 PDB entries)
  8. 2353323Domain d5xajb2: 5xaj B:107-214 [335511]
    Other proteins in same PDB: d5xajb1, d5xajc1, d5xajd1, d5xajl1
    automated match to d1dn0a2

Details for d5xajb2

PDB Entry: 5xaj (more details), 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.
PDB Compounds: (B:) FabHM14c10 light chain

SCOPe Domain Sequences for d5xajb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xajb2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5xajb2:

Click to download the PDB-style file with coordinates for d5xajb2.
(The format of our PDB-style files is described here.)

Timeline for d5xajb2: