SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xajb2 (5xaj B:107-214)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2292209Species Dengue virus [TaxId:12637] [335510] (1 PDB entry)
  8. 2292210Domain d5xajb2: 5xaj B:107-214 [335511]
    Other proteins in same PDB: d5xajb1, d5xajc1
    automated match to d1dn0a2

Details for d5xajb2

PDB Entry: 5xaj (more details), 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.
PDB Compounds: (B:) FabHM14c10 light chain

SCOPe Domain Sequences for d5xajb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xajb2 b.1.1.2 (B:107-214) automated matches {Dengue virus [TaxId: 12637]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5xajb2:

Click to download the PDB-style file with coordinates for d5xajb2.
(The format of our PDB-style files is described here.)

Timeline for d5xajb2:

  • d5xajb2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5xajb1