SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5xajb1 (5xaj B:1-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2292207Species Dengue virus [TaxId:12637] [335508] (1 PDB entry)
  8. 2292208Domain d5xajb1: 5xaj B:1-106 [335509]
    Other proteins in same PDB: d5xajb2, d5xajc2
    automated match to d1dn0a1

Details for d5xajb1

PDB Entry: 5xaj (more details), 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.
PDB Compounds: (B:) FabHM14c10 light chain

SCOPe Domain Sequences for d5xajb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xajb1 b.1.1.0 (B:1-106) automated matches {Dengue virus [TaxId: 12637]}
divmtqspgtlslspgeratlscrasqnvysylgwyqhkpgrsprllifgvtsratgvpd
rfsgsgsgtdftltisrlepedfavyycqqyagsaytfgqgtkvei

SCOPe Domain Coordinates for d5xajb1:

Click to download the PDB-style file with coordinates for d5xajb1.
(The format of our PDB-style files is described here.)

Timeline for d5xajb1:

  • d5xajb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5xajb2