SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w15a1 (5w15 A:1-267)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (82 species)
    not a true protein
  7. 2292196Species Burkholderia ambifaria [TaxId:398577] [335497] (1 PDB entry)
  8. 2292197Domain d5w15a1: 5w15 A:1-267 [335498]
    Other proteins in same PDB: d5w15a2, d5w15b2, d5w15c2, d5w15d2
    automated match to d4lxga_
    complexed with cl, edo, mg

Details for d5w15a1

PDB Entry: 5w15 (more details), 1.75 Å

PDB Description: crystal structure of an alpha/beta hydrolase fold protein from burkholderia ambifaria.
PDB Compounds: (A:) Alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d5w15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w15a1 c.69.1.0 (A:1-267) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mldlanrfnfeghriawgtlgegpplvlvhgtpfssqvwrriapwlarrhrvffydllgy
gqsdmpdadvslgrqnvlfgalldewkisrprvlahdyggatvlrahfldgiaysdltlv
npvaiapqgspfvrhvaqheaaftglpayahhalvsayigqavaqplsddvlsiyrapwl
tpagqaafyrqiaqmrqryiedaearyappdfpvrivwgeddrwipleqgqaladriang
klirvpraghlvqedapeaivaavldr

SCOPe Domain Coordinates for d5w15a1:

Click to download the PDB-style file with coordinates for d5w15a1.
(The format of our PDB-style files is described here.)

Timeline for d5w15a1:

  • d5w15a1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15