SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w1fg_ (5w1f G:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994354Protein Calcyclin (S100) [47479] (17 species)
  7. 1994411Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (5 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 2292189Domain d5w1fg_: 5w1f G: [335490]
    Other proteins in same PDB: d5w1fb_, d5w1fd_, d5w1ff_, d5w1fh_
    automated match to d1xk4a1
    complexed with ca, na, ni

Details for d5w1fg_

PDB Entry: 5w1f (more details), 2.6 Å

PDB Description: crystal structure of ni(ii)- and ca(ii)-bound human calprotectin
PDB Compounds: (G:) Protein S100-A8

SCOPe Domain Sequences for d5w1fg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1fg_ a.39.1.2 (G:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshe

SCOPe Domain Coordinates for d5w1fg_:

Click to download the PDB-style file with coordinates for d5w1fg_.
(The format of our PDB-style files is described here.)

Timeline for d5w1fg_:

  • d5w1fg_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15