Lineage for d1jaw_1 (1jaw 1-176)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586622Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 586623Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 586624Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 586628Species Escherichia coli [TaxId:562] [53097] (5 PDB entries)
  8. 586638Domain d1jaw_1: 1jaw 1-176 [33549]
    Other proteins in same PDB: d1jaw_2
    complexed with act, mn

Details for d1jaw_1

PDB Entry: 1jaw (more details), 2.7 Å

PDB Description: aminopeptidase p from e. coli low ph form

SCOP Domain Sequences for d1jaw_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jaw_1 c.55.2.1 (1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwygrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d1jaw_1:

Click to download the PDB-style file with coordinates for d1jaw_1.
(The format of our PDB-style files is described here.)

Timeline for d1jaw_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jaw_2