SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5v84b_ (5v84 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (612 PDB entries)
  8. 2292187Domain d5v84b_: 5v84 B: [335488]
    automated match to d4nyxa_
    complexed with 96v, so4

Details for d5v84b_

PDB Entry: 5v84 (more details), 2.7 Å

PDB Description: cecr2 in complex with cpd6 (6-allyl-n,2-dimethyl-7-oxo-n-(1-(1- phenylethyl)piperidin-4-yl)-6,7-dihydro-1h-pyrrolo[2,3-c]pyridine-4- carboxamide)
PDB Compounds: (B:) Cat eye syndrome critical region protein 2

SCOPe Domain Sequences for d5v84b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5v84b_ a.29.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdissmekklngglyctke
efvndmktmfrncrkyngesseytkmsdnlercfhrammkh

SCOPe Domain Coordinates for d5v84b_:

Click to download the PDB-style file with coordinates for d5v84b_.
(The format of our PDB-style files is described here.)

Timeline for d5v84b_:

  • d5v84b_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15