SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vc1a2 (5vc1 A:119-153)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2230373Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2230991Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2230992Protein automated matches [226968] (4 species)
    not a true protein
  7. 2230993Species Human (Homo sapiens) [TaxId:9606] [225423] (26 PDB entries)
  8. 2292185Domain d5vc1a2: 5vc1 A:119-153 [335486]
    Other proteins in same PDB: d5vc1a1
    automated match to d1g1ta2
    complexed with bma, ca, gol, man, nag, peg, pg4

Details for d5vc1a2

PDB Entry: 5vc1 (more details), 1.94 Å

PDB Description: crystal structure of l-selectin lectin/egf domains
PDB Compounds: (A:) L-selectin

SCOPe Domain Sequences for d5vc1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vc1a2 g.3.11.0 (A:119-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tascqpwscsghgecveiinqytcncdvgyygpqc

SCOPe Domain Coordinates for d5vc1a2:

Click to download the PDB-style file with coordinates for d5vc1a2.
(The format of our PDB-style files is described here.)

Timeline for d5vc1a2:

  • d5vc1a2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5vc1a1