Lineage for d5w05l1 (5w05 L:1-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (590 PDB entries)
  8. 2357877Domain d5w05l1: 5w05 L:1-112 [335483]
    Other proteins in same PDB: d5w05l2
    automated match to d1dn0a1
    complexed with peg

Details for d5w05l1

PDB Entry: 5w05 (more details), 1.64 Å

PDB Description: anti-tissue factor antibody m59, a humanized version of 10h10
PDB Compounds: (L:) m59 fab light chain

SCOPe Domain Sequences for d5w05l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w05l1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvtpgepasisckssqsllssgnqknyltwylqkpgqspqlliywastr
esgvpdrfsgsgsgtdftlkisrveaedvgvyycqndytypltfgqgtklei

SCOPe Domain Coordinates for d5w05l1:

Click to download the PDB-style file with coordinates for d5w05l1.
(The format of our PDB-style files is described here.)

Timeline for d5w05l1: