SCOPe 2.08: Domain d1a16a1: 1a16 A:1-176

Lineage for d1a16a1 (1a16 A:1-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein Aminopeptidase P [53096] (2 species)
   synonym: Xaa-Pro dipeptidase, prolidase

7. Species Escherichia coli [TaxId:562] [53097] (20 PDB entries)

8. Domain d1a16a1: 1a16 A:1-176 [33548]
   Other proteins in same PDB: d1a16a2
   complexed with leu, mn, pro

Details for d1a16a1

PDB Entry: 1a16, 2.3 Å

PDB Description: aminopeptidase p from e. coli with the inhibitor pro-leu

PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d1a16a1:

Sequence, based on SEQRES records:

>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Sequence, based on observed residues (ATOM records):

>d1a16a1 c.55.2.1 (A:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d1a16a1:

• d1a16a1 first appeared (with stable ids) in SCOP 1.55, called d1a16_1
  
• d1a16a1 appears in SCOPe 2.07