SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5vnpa_ (5vnp A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134682Family c.69.1.8: Haloalkane dehalogenase [53513] (2 protein domains)
  6. 2134722Protein automated matches [190880] (5 species)
    not a true protein
  7. 2134728Species Rhodococcus rhodochrous [TaxId:1829] [189127] (14 PDB entries)
  8. 2292175Domain d5vnpa_: 5vnp A: [335476]
    automated match to d1cqwa_
    complexed with 9fm, cl

Details for d5vnpa_

PDB Entry: 5vnp (more details), 2.23 Å

PDB Description: x-ray crystal structure of halotag bound to the p1 benzoxadiazole fluorogenic ligand
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d5vnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vnpa_ c.69.1.8 (A:) automated matches {Rhodococcus rhodochrous [TaxId: 1829]}
igtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapthrcia
pdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakrnperv
kgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvvrplte
vemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkllfwgtp
gvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstl

SCOPe Domain Coordinates for d5vnpa_:

Click to download the PDB-style file with coordinates for d5vnpa_.
(The format of our PDB-style files is described here.)

Timeline for d5vnpa_:

  • d5vnpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15