Lineage for d5w1fh_ (5w1f H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710348Protein automated matches [190132] (4 species)
    not a true protein
  7. 2710351Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2710426Domain d5w1fh_: 5w1f H: [335475]
    Other proteins in same PDB: d5w1fa_, d5w1fc_, d5w1fe_, d5w1fg_
    automated match to d5i8nb_
    complexed with ca, na, ni

Details for d5w1fh_

PDB Entry: 5w1f (more details), 2.6 Å

PDB Description: crystal structure of ni(ii)- and ca(ii)-bound human calprotectin
PDB Compounds: (H:) Protein S100-A9

SCOPe Domain Sequences for d5w1fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w1fh_ a.39.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge

SCOPe Domain Coordinates for d5w1fh_:

Click to download the PDB-style file with coordinates for d5w1fh_.
(The format of our PDB-style files is described here.)

Timeline for d5w1fh_: