Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
Protein automated matches [190132] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries) |
Domain d5w1fh_: 5w1f H: [335475] Other proteins in same PDB: d5w1fa_, d5w1fc_, d5w1fe_, d5w1fg_ automated match to d5i8nb_ complexed with ca, na, ni |
PDB Entry: 5w1f (more details), 2.6 Å
SCOPe Domain Sequences for d5w1fh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w1fh_ a.39.1.2 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
Timeline for d5w1fh_: