Lineage for d5vy5d_ (5vy5 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085377Protein Fructose-1,6-bisphosphate aldolase [51576] (11 species)
  7. 2085436Species Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId:9986] [51580] (31 PDB entries)
  8. 2292172Domain d5vy5d_: 5vy5 D: [335473]
    automated match to d1zaha1

Details for d5vy5d_

PDB Entry: 5vy5 (more details), 2.6 Å

PDB Description: rabbit muscle aldolase using 200kev
PDB Compounds: (D:) Fructose-bisphosphate aldolase A

SCOPe Domain Sequences for d5vy5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5vy5d_ c.1.10.1 (D:) Fructose-1,6-bisphosphate aldolase {Rabbit (Oryctolagus cuniculus), muscle isozyme [TaxId: 9986]}
hshpaltpeqkkelsdiahrivapgkgilaadestgsiakrlqsigtenteenrrfyrql
lltaddrvnpciggvilfhetlyqkaddgrpfpqvikskggvvgikvdkgvvplagtnge
tttqgldglsercaqykkdgadfakwrcvlkigehtpsalaimenanvlaryasicqqng
ivpivepeilpdgdhdlkrcqyvtekvlaavykalsdhhiylegtllkpnmvtpghactq
kysheeiamatvtalrrtvppavtgvtflsggqseeeasinlnainkcpllkpwaltfsy
gralqasalkawggkkenlkaaqeeyvkralanslacqgkytp

SCOPe Domain Coordinates for d5vy5d_:

Click to download the PDB-style file with coordinates for d5vy5d_.
(The format of our PDB-style files is described here.)

Timeline for d5vy5d_:

  • d5vy5d_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15