Lineage for d5ueva1 (5uev A:352-457)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1992367Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1992467Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1992468Protein automated matches [190615] (10 species)
    not a true protein
  7. 1992472Species Human (Homo sapiens) [TaxId:9606] [187641] (642 PDB entries)
  8. 2292171Domain d5ueva1: 5uev A:352-457 [335472]
    Other proteins in same PDB: d5ueva2
    automated match to d2ouoa_
    complexed with 88y

Details for d5ueva1

PDB Entry: 5uev (more details), 1.94 Å

PDB Description: brd4_bd2_a-556343
PDB Compounds: (A:) Bromodomain-containing protein 4

SCOPe Domain Sequences for d5ueva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ueva1 a.29.2.0 (A:352-457) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqlkccsgilkemfakkhaayawpfykpvdvealglhdycdiikhpmdmstikskleare
yrdaqefgadvrlmfsncykynppdhevvamarklqdvfemrfakm

SCOPe Domain Coordinates for d5ueva1:

Click to download the PDB-style file with coordinates for d5ueva1.
(The format of our PDB-style files is described here.)

Timeline for d5ueva1:

  • d5ueva1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5ueva2