SCOPe 2.07: Domain d5kgtb_: 5kgt B:

Lineage for d5kgtb_ (5kgt B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Mycobacterium bovis [TaxId:233413] [334928] (3 PDB entries)

8. Domain d5kgtb_: 5kgt B: [335459]
   automated match to d4cxqa_
   complexed with 6sq, plp

Details for d5kgtb_

PDB Entry: 5kgt, 2.25 Å

PDB Description: crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone

PDB Compounds: (B:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase

SCOPe Domain Sequences for d5kgtb_:

Sequence; same for both SEQRES and ATOM records:

>d5kgtb_ c.67.1.0 (B:) automated matches {Mycobacterium bovis [TaxId: 233413]}
gltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwt
aihghghpaldqalttqlrvmnhvmfgglthepaarlakllvditpagldtvffsdsgsv
svevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqv
fapqvprdydpaysaafeaqlaqhagelaavvvepvvqgaggmrfhdprylhdlrdicrr
yevllifdeiatgfgrtgalfaadhagvspdimcvgkaltggylslaatlctadvahtis
agaagalmhgptfmanplacavsvasvelllgqdwrtritelaagltagldtaralpavt
dvrvcgaigviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsam
vevarlvgs

Timeline for d5kgtb_:

• d5kgtb_ first appeared in SCOPe 2.06
  
• d5kgtb_ appears in the current release, SCOPe 2.08