Lineage for d5n74h_ (5n74 H:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343400Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2343401Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2343402Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 protein domains)
    Pfam PF03271
  6. 2343403Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2343427Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry)
  8. 2343435Domain d5n74h_: 5n74 H: [335456]
    automated match to d1wu9a1

Details for d5n74h_

PDB Entry: 5n74 (more details), 2.3 Å

PDB Description: microtubule end binding protein complex
PDB Compounds: (H:) Uncharacterized protein

SCOPe Domain Sequences for d5n74h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n74h_ a.245.1.1 (H:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]}
aaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

SCOPe Domain Coordinates for d5n74h_:

Click to download the PDB-style file with coordinates for d5n74h_.
(The format of our PDB-style files is described here.)

Timeline for d5n74h_: