SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n74h_ (5n74 H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015959Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2015960Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2015961Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 protein domains)
    Pfam PF03271
  6. 2015962Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2292074Species Otolemur garnettii [TaxId:30611] [335375] (1 PDB entry)
  8. 2292155Domain d5n74h_: 5n74 H: [335456]
    automated match to d1wu9a1

Details for d5n74h_

PDB Entry: 5n74 (more details), 2.3 Å

PDB Description: microtubule end binding protein complex
PDB Compounds: (H:) Uncharacterized protein

SCOPe Domain Sequences for d5n74h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n74h_ a.245.1.1 (H:) Microtubule-associated protein EB1, C-terminal dimerization domain {Otolemur garnettii [TaxId: 30611]}
aaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

SCOPe Domain Coordinates for d5n74h_:

Click to download the PDB-style file with coordinates for d5n74h_.
(The format of our PDB-style files is described here.)

Timeline for d5n74h_:

  • d5n74h_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15