![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (13 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (123 PDB entries) |
![]() | Domain d5t0ed_: 5t0e D: [335455] Other proteins in same PDB: d5t0ea_, d5t0ec_, d5t0ee_ automated match to d4kdmb_ complexed with gal, nag, sia; mutant |
PDB Entry: 5t0e (more details), 2.09 Å
SCOPe Domain Sequences for d5t0ed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t0ed_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi
Timeline for d5t0ed_: