Lineage for d5t08e_ (5t08 E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (33 species)
    not a true protein
  7. 2041012Species Influenza a virus [TaxId:119212] [270847] (8 PDB entries)
  8. 2292151Domain d5t08e_: 5t08 E: [335452]
    Other proteins in same PDB: d5t08b_, d5t08d_, d5t08f_
    automated match to d4xkga_
    complexed with nag; mutant

Details for d5t08e_

PDB Entry: 5t08 (more details), 2.19 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d5t08e_:

Sequence, based on SEQRES records: (download)

>d5t08e_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 119212]}
pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
plwigecpkyvkseslrlatglrnvpq

Sequence, based on observed residues (ATOM records): (download)

>d5t08e_ b.19.1.0 (E:) automated matches {Influenza a virus [TaxId: 119212]}
pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
etlnvesngnliapwyaykfvskkgavfksdlpiencdatcqtitgvlrtnktfqnvspl
wigecpkyvkseslrlatglrnvpq

SCOPe Domain Coordinates for d5t08e_:

Click to download the PDB-style file with coordinates for d5t08e_.
(The format of our PDB-style files is described here.)

Timeline for d5t08e_:

  • d5t08e_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15