SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5o41a_ (5o41 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976488Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 1978082Protein Myoglobin [46469] (9 species)
  7. 1978220Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (263 PDB entries)
    Uniprot P02185
  8. 2292150Domain d5o41a_: 5o41 A: [335451]
    automated match to d2mbwa_
    complexed with cmo, hem, so4

Details for d5o41a_

PDB Entry: 5o41 (more details), 1.8 Å

PDB Description: low-dose fixed target serial synchrotron crystallography structure of sperm whale myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5o41a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5o41a_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d5o41a_:

Click to download the PDB-style file with coordinates for d5o41a_.
(The format of our PDB-style files is described here.)

Timeline for d5o41a_:

  • d5o41a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15