SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tjka1 (5tjk A:64-345)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133477Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 protein domains)
    automatically mapped to Pfam PF03414
  6. 2133594Protein automated matches [190178] (2 species)
    not a true protein
  7. 2133601Species Human (Homo sapiens) [TaxId:9606] [186910] (68 PDB entries)
  8. 2292148Domain d5tjka1: 5tjk A:64-345 [335449]
    Other proteins in same PDB: d5tjka2
    automated match to d3zgfa_
    complexed with bga, gol

Details for d5tjka1

PDB Entry: 5tjk (more details)

PDB Description: crystal structure of gta + a trisaccharide (native)
PDB Compounds: (A:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d5tjka1:

Sequence, based on SEQRES records: (download)

>d5tjka1 c.68.1.9 (A:64-345) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d5tjka1 c.68.1.9 (A:64-345) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevrrwqdvsm
rrmemisfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssreaftye
rrpqsqayipkdegdfyylggffggsvqevqrltrachqammvdqangieavwhdeshln
kyllrhkptkvlspeylwdqqllgwpavlrklrftavp

SCOPe Domain Coordinates for d5tjka1:

Click to download the PDB-style file with coordinates for d5tjka1.
(The format of our PDB-style files is described here.)

Timeline for d5tjka1:

  • d5tjka1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5tjka2