![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d5iuee2: 5iue E:182-276 [335448] Other proteins in same PDB: d5iuea1, d5iueb_, d5iuee1, d5iuef_, d5iueg1, d5iueh_, d5iuei1, d5iuej_ automated match to d1efxa1 |
PDB Entry: 5iue (more details), 2.62 Å
SCOPe Domain Sequences for d5iuee2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iuee2 b.1.1.0 (E:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]} adppkahvahhpisdheatlrcwalgfypaeitltwqrdgeeqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpqplilrweq
Timeline for d5iuee2: