Lineage for d5ne43_ (5ne4 3:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2075627Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2075905Protein automated matches [190854] (15 species)
    not a true protein
  7. 2292138Species Foot-and-mouth disease virus - type o [TaxId:12118] [335439] (2 PDB entries)
  8. 2292139Domain d5ne43_: 5ne4 3: [335440]
    automated match to d1qqp3_

Details for d5ne43_

PDB Entry: 5ne4 (more details), 2.3 Å

PDB Description: crystal structure of foot and mouth disease virus o panasia
PDB Compounds: (3:) Polyprotein

SCOPe Domain Sequences for d5ne43_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ne43_ b.121.4.1 (3:) automated matches {Foot-and-mouth disease virus - type o [TaxId: 12118]}
gifpvacsdgygglvttdpktadpaygkvfnpprnmlpgrftnfldvaeacptflrfegd
vpyvttktdsdrilaqfdlslaakhmsntflaglaqyytqysgtinlhfmftgptdakar
ymiayappgmeppktpeaaahcihaewdtglnskftfsipylsaadyaytasdtaettnv
qgwvclfqithgkadgdalvvlasagkdfelrlpvdart

SCOPe Domain Coordinates for d5ne43_:

Click to download the PDB-style file with coordinates for d5ne43_.
(The format of our PDB-style files is described here.)

Timeline for d5ne43_:

  • d5ne43_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from other chains:
(mouse over for more information)
d5ne41_