SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ne43_ (5ne4 3:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2075627Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 protein domains)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2075905Protein automated matches [190854] (13 species)
    not a true protein
  7. 2292138Species Foot-and-mouth disease virus - type o [TaxId:12118] [335439] (1 PDB entry)
  8. 2292139Domain d5ne43_: 5ne4 3: [335440]
    automated match to d1qqp3_

Details for d5ne43_

PDB Entry: 5ne4 (more details), 2.3 Å

PDB Description: crystal structure of foot and mouth disease virus o panasia
PDB Compounds: (3:) Polyprotein

SCOPe Domain Sequences for d5ne43_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ne43_ b.121.4.1 (3:) automated matches {Foot-and-mouth disease virus - type o [TaxId: 12118]}
gifpvacsdgygglvttdpktadpaygkvfnpprnmlpgrftnfldvaeacptflrfegd
vpyvttktdsdrilaqfdlslaakhmsntflaglaqyytqysgtinlhfmftgptdakar
ymiayappgmeppktpeaaahcihaewdtglnskftfsipylsaadyaytasdtaettnv
qgwvclfqithgkadgdalvvlasagkdfelrlpvdart

SCOPe Domain Coordinates for d5ne43_:

Click to download the PDB-style file with coordinates for d5ne43_.
(The format of our PDB-style files is described here.)

Timeline for d5ne43_:

  • d5ne43_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from other chains:
(mouse over for more information)
d5ne41_