Lineage for d5t0ra_ (5t0r A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045100Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2045101Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2045249Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2045274Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2045291Species Mus musculus [TaxId:10090] [335436] (1 PDB entry)
  8. 2045292Domain d5t0ra_: 5t0r A: [335437]
    automated match to d2k45a_
    complexed with cd

Details for d5t0ra_

PDB Entry: 5t0r (more details), 1.95 Å

PDB Description: synaptotagmin 1 c2a domain, cadmium-bound
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5t0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0ra_ b.7.1.2 (A:) Synaptogamin I {Mus musculus [TaxId: 10090]}
klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
dlqsa

SCOPe Domain Coordinates for d5t0ra_:

Click to download the PDB-style file with coordinates for d5t0ra_.
(The format of our PDB-style files is described here.)

Timeline for d5t0ra_: