SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t0ra_ (5t0r A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038208Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2292135Species Mus musculus [TaxId:10090] [335436] (1 PDB entry)
  8. 2292136Domain d5t0ra_: 5t0r A: [335437]
    automated match to d2k45a_
    complexed with cd

Details for d5t0ra_

PDB Entry: 5t0r (more details), 1.95 Å

PDB Description: synaptotagmin 1 c2a domain, cadmium-bound
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5t0ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0ra_ b.7.1.2 (A:) Synaptogamin I {Mus musculus [TaxId: 10090]}
klgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhrk
tlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteewr
dlqsa

SCOPe Domain Coordinates for d5t0ra_:

Click to download the PDB-style file with coordinates for d5t0ra_.
(The format of our PDB-style files is described here.)

Timeline for d5t0ra_:

  • d5t0ra_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15