Lineage for d5n28b2 (5n28 B:189-444)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004845Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2004846Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2004923Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2004924Protein automated matches [227075] (4 species)
    not a true protein
  7. 2004933Species Methanotorris formicicus [TaxId:647171] [335416] (2 PDB entries)
  8. 2004935Domain d5n28b2: 5n28 B:189-444 [335435]
    Other proteins in same PDB: d5n28b1, d5n28c_, d5n28e1, d5n28f_
    automated match to d1hbnb1

Details for d5n28b2

PDB Entry: 5n28 (more details)

PDB Description: methyl-coenzyme m reductase iii from methanotorris formicicus monoclinic form
PDB Compounds: (B:) Methyl-coenzyme M reductase, beta subunit

SCOPe Domain Sequences for d5n28b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n28b2 a.89.1.0 (B:189-444) automated matches {Methanotorris formicicus [TaxId: 647171]}
gyalrnimvnhyvattkknimnavafasimeqtamfemgdaigsferlhllglayqglna
dnlvidlvkangkngtvgtvvasiveraledgvitedkkmpsgfvlykpvdvakwnayaa
aglvaavivncgaaraaqnvastilyyndiieyetglpgvdfgraegtavgfsffshsiy
ggggpgifngnhivtrhskgfaippvcaamcvdagtqmfspektsalvgavfsaidefre
plkyvidgalavkdki

SCOPe Domain Coordinates for d5n28b2:

Click to download the PDB-style file with coordinates for d5n28b2.
(The format of our PDB-style files is described here.)

Timeline for d5n28b2: