Lineage for d5ncfa1 (5ncf A:1-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061957Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 protein domains)
  6. 2061993Protein automated matches [226957] (1 species)
    not a true protein
  7. 2061994Species Human (Homo sapiens) [TaxId:9606] [225382] (4 PDB entries)
  8. 2292131Domain d5ncfa1: 5ncf A:1-111 [335432]
    Other proteins in same PDB: d5ncfa2
    automated match to d2iyba_
    complexed with 8t5, gol, no3, so4

Details for d5ncfa1

PDB Entry: 5ncf (more details), 1.4 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-4]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d5ncfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ncfa1 b.55.1.4 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5ncfa1:

Click to download the PDB-style file with coordinates for d5ncfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ncfa1:

  • d5ncfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5ncfa2
View in 3D
Domains from other chains:
(mouse over for more information)
d5ncfb_