SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ncfa1 (5ncf A:1-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061576Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2061577Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2061957Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 protein domains)
  6. 2061993Protein automated matches [226957] (1 species)
    not a true protein
  7. 2061994Species Human (Homo sapiens) [TaxId:9606] [225382] (4 PDB entries)
  8. 2292131Domain d5ncfa1: 5ncf A:1-111 [335432]
    Other proteins in same PDB: d5ncfa2
    automated match to d2iyba_
    complexed with 8t5, gol, no3, so4

Details for d5ncfa1

PDB Entry: 5ncf (more details), 1.4 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-4]-oh
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d5ncfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ncfa1 b.55.1.4 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5ncfa1:

Click to download the PDB-style file with coordinates for d5ncfa1.
(The format of our PDB-style files is described here.)

Timeline for d5ncfa1:

  • d5ncfa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15