SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tkma_ (5tkm A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2147804Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2147805Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2148016Family c.97.1.6: apolipoprotein B messenger RNA-editing enzyme catalytic (APOBEC) cytidine deaminase domains [310632] (5 protein domains)
    strand 5 is parallel to strand 4
    Pfam PF08210; Pfam PF05240
  6. 2148040Protein automated matches [310855] (3 species)
    not a true protein
  7. 2148041Species Human (Homo sapiens) [TaxId:9606] [311219] (17 PDB entries)
  8. 2292129Domain d5tkma_: 5tkm A: [335430]
    automated match to d3vm8a_
    complexed with zn

Details for d5tkma_

PDB Entry: 5tkm (more details), 1.9 Å

PDB Description: crystal structure of human apobec3b n-terminal domain
PDB Compounds: (A:) DNA dC->dU-editing enzyme APOBEC-3B

SCOPe Domain Sequences for d5tkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tkma_ c.97.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npmermdrdtfydnfenepilsgrsytwlcyevkikrgrsnllwdtgvfrgqvyfkpqyh
aemcflswfcgnqlpadkcfqitwfvswtpcpdcvaklaeflsehpnvtltisaarlyyy
serdyrralcrlsqagarvkimdyeefaycwenfvdnegqqfmpwykfdenyaflhrtlk
eilr

SCOPe Domain Coordinates for d5tkma_:

Click to download the PDB-style file with coordinates for d5tkma_.
(The format of our PDB-style files is described here.)

Timeline for d5tkma_:

  • d5tkma_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15