SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t08a_ (5t08 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040896Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2040897Protein automated matches [227017] (29 species)
    not a true protein
  7. 2041012Species Influenza a virus [TaxId:119212] [270847] (8 PDB entries)
  8. 2292125Domain d5t08a_: 5t08 A: [335426]
    Other proteins in same PDB: d5t08b_, d5t08d_
    automated match to d4xkga_
    complexed with nag; mutant

Details for d5t08a_

PDB Entry: 5t08 (more details), 2.19 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5t08a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t08a_ b.19.1.0 (A:) automated matches {Influenza a virus [TaxId: 119212]}
pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
plwigecpkyvkseslrlatglrnvpqiat

SCOPe Domain Coordinates for d5t08a_:

Click to download the PDB-style file with coordinates for d5t08a_.
(The format of our PDB-style files is described here.)

Timeline for d5t08a_:

  • d5t08a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15