SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h6va_ (5h6v A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2237459Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 2237460Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 2281084Family g.96.1.0: automated matches [324385] (1 protein)
    not a true family
  6. 2281085Protein automated matches [324386] (2 species)
    not a true protein
  7. 2283836Species Zika virus [TaxId:64320] [327137] (3 PDB entries)
  8. 2292124Domain d5h6va_: 5h6v A: [335425]
    Other proteins in same PDB: d5h6vb_
    automated match to d2ggva_
    complexed with 7hs

Details for d5h6va_

PDB Entry: 5h6v (more details), 2.42 Å

PDB Description: structure of zika virus protease in complex with a dipeptide inhibitor
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d5h6va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h6va_ g.96.1.0 (A:) automated matches {Zika virus [TaxId: 64320]}
dmyieragditwekdaevtgnsprldvaldesgdfslv

SCOPe Domain Coordinates for d5h6va_:

Click to download the PDB-style file with coordinates for d5h6va_.
(The format of our PDB-style files is described here.)

Timeline for d5h6va_:

  • d5h6va_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15