SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5nnrb_ (5nnr B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2187564Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2187565Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2188102Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2188103Protein automated matches [190038] (40 species)
    not a true protein
  7. 2292122Species Chaetomium thermophilum [TaxId:209285] [335423] (1 PDB entry)
  8. 2292123Domain d5nnrb_: 5nnr B: [335424]
    automated match to d4kvme_

Details for d5nnrb_

PDB Entry: 5nnr (more details)

PDB Description: structure of naa15/naa10 bound to hypk-thb
PDB Compounds: (B:) Naa10

SCOPe Domain Sequences for d5nnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nnrb_ d.108.1.0 (B:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
mdirllrpsdipliqhanlenlpenyflkyylyhalswpqlsfvavdvsrpakspydypk
ivgyvlakmeeepadgvphghitslsvmrthrrlgiaeklmrqsqlamvetynahyvslh
vrvsnkaaihlyrdtlgfktekveakyyadgedaycmkldltalreqiaaqreke

SCOPe Domain Coordinates for d5nnrb_:

Click to download the PDB-style file with coordinates for d5nnrb_.
(The format of our PDB-style files is described here.)

Timeline for d5nnrb_:

  • d5nnrb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15