Lineage for d5nnrb_ (5nnr B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (43 species)
    not a true protein
  7. 2533824Species Chaetomium thermophilum [TaxId:209285] [335423] (1 PDB entry)
  8. 2533825Domain d5nnrb_: 5nnr B: [335424]
    automated match to d4kvme_

Details for d5nnrb_

PDB Entry: 5nnr (more details), 3.1 Å

PDB Description: structure of naa15/naa10 bound to hypk-thb
PDB Compounds: (B:) Naa10

SCOPe Domain Sequences for d5nnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nnrb_ d.108.1.0 (B:) automated matches {Chaetomium thermophilum [TaxId: 209285]}
mdirllrpsdipliqhanlenlpenyflkyylyhalswpqlsfvavdvsrpakspydypk
ivgyvlakmeeepadgvphghitslsvmrthrrlgiaeklmrqsqlamvetynahyvslh
vrvsnkaaihlyrdtlgfktekveakyyadgedaycmkldltalreqiaaqreke

SCOPe Domain Coordinates for d5nnrb_:

Click to download the PDB-style file with coordinates for d5nnrb_.
(The format of our PDB-style files is described here.)

Timeline for d5nnrb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5nnre_