Lineage for d5iueg1 (5iue G:2-181)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163006Family d.19.1.1: MHC antigen-recognition domain [54453] (13 protein domains)
  6. 2163926Protein automated matches [191280] (3 species)
    not a true protein
  7. 2163933Species Human (Homo sapiens) [TaxId:9606] [189896] (27 PDB entries)
  8. 2292118Domain d5iueg1: 5iue G:2-181 [335419]
    Other proteins in same PDB: d5iuea2, d5iueb_, d5iuee2, d5iuef_, d5iueg2, d5iueh_, d5iuei2, d5iuej_
    automated match to d1efxa2
    complexed with nag

Details for d5iueg1

PDB Entry: 5iue (more details), 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors
PDB Compounds: (G:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iueg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iueg1 d.19.1.1 (G:2-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shslryfstavsrpgrgepryiaveyvddtqflrfdsdaaiprmeprepwveqegpqywe
wttgyakanaqtdrvalrnllrrynqseagshtlqgmngcdmgpdgrllrgyhqhaydgk
dyislnedlrswtaadtvaqitqrfyeaeeyaeefrtylegeclellrrylengketlqr

SCOPe Domain Coordinates for d5iueg1:

Click to download the PDB-style file with coordinates for d5iueg1.
(The format of our PDB-style files is described here.)

Timeline for d5iueg1:

  • d5iueg1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15