SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jq1a_ (5jq1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2209545Species Human (Homo sapiens) [TaxId:9606] [186882] (77 PDB entries)
  8. 2292117Domain d5jq1a_: 5jq1 A: [335418]
    automated match to d4gj0a_
    complexed with ca, cl, zpf

Details for d5jq1a_

PDB Entry: 5jq1 (more details), 1.83 Å

PDB Description: efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactosamine mimic
PDB Compounds: (A:) asialoglycoprotein receptor 1

SCOPe Domain Sequences for d5jq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jq1a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntw
mglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqr
pyrwvcetel

SCOPe Domain Coordinates for d5jq1a_:

Click to download the PDB-style file with coordinates for d5jq1a_.
(The format of our PDB-style files is described here.)

Timeline for d5jq1a_:

  • d5jq1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

2292117
d5jq1a_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d5jq1b_