Lineage for d5jq1a_ (5jq1 A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208774Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2208775Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2209498Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2209499Protein automated matches [190159] (15 species)
    not a true protein
  7. 2209545Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2292117Domain d5jq1a_: 5jq1 A: [335418]
    automated match to d4gj0a_
    complexed with ca, cl, zpf

Details for d5jq1a_

PDB Entry: 5jq1 (more details), 1.83 Å

PDB Description: efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactosamine mimic
PDB Compounds: (A:) asialoglycoprotein receptor 1

SCOPe Domain Sequences for d5jq1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jq1a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntw
mglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqr
pyrwvcetel

SCOPe Domain Coordinates for d5jq1a_:

Click to download the PDB-style file with coordinates for d5jq1a_.
(The format of our PDB-style files is described here.)

Timeline for d5jq1a_:

  • d5jq1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15