SCOPe 2.07: Domain d5jq1a_: 5jq1 A:

Lineage for d5jq1a_ (5jq1 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d5jq1a_: 5jq1 A: [335418]
   automated match to d4gj0a_
   complexed with ca, cl, zpf

Details for d5jq1a_

PDB Entry: 5jq1, 1.83 Å

PDB Description: efficient targeting of the asialoglycoprotein receptor by polyvalent display of a compact galactosamine mimic

PDB Compounds: (A:) asialoglycoprotein receptor 1

SCOPe Domain Sequences for d5jq1a_:

Sequence; same for both SEQRES and ATOM records:

>d5jq1a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tccpvnwveherscywfsrsgkawadadnycrledahlvvvtsweeqkfvqhhigpvntw
mglhdqngpwkwvdgtdyetgfknwrpeqpddwyghglgggedcahftddgrwnddvcqr
pyrwvcetel

Timeline for d5jq1a_:

• d5jq1a_ first appeared in SCOPe 2.06