SCOPe 2.06: Domain d5t0bd_: 5t0b D:

Lineage for d5t0bd_ (5t0b D:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (12 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)

8. Domain d5t0bd_: 5t0b D: [335414]
   Other proteins in same PDB: d5t0ba_, d5t0bc_, d5t0be_
   automated match to d4kdmb_
   complexed with gal, nag, sia; mutant

Details for d5t0bd_

PDB Entry: 5t0b, 2 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with 6'-sln

PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t0bd_:

Sequence; same for both SEQRES and ATOM records:

>d5t0bd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

Timeline for d5t0bd_:

• d5t0bd_ is new in SCOPe 2.06-stable
  
• d5t0bd_ appears in SCOPe 2.07
  
• d5t0bd_ appears in the current release, SCOPe 2.08