Lineage for d5t0bd_ (5t0b D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2238958Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2292113Domain d5t0bd_: 5t0b D: [335414]
    Other proteins in same PDB: d5t0ba_, d5t0bc_, d5t0be_
    automated match to d4kdmb_
    complexed with gal, nag, sia; mutant

Details for d5t0bd_

PDB Entry: 5t0b (more details), 2 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with 6'-sln
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t0bd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0bd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqg

SCOPe Domain Coordinates for d5t0bd_:

Click to download the PDB-style file with coordinates for d5t0bd_.
(The format of our PDB-style files is described here.)

Timeline for d5t0bd_:

  • d5t0bd_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15