Lineage for d5t0sa_ (5t0s A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038246Protein automated matches [190234] (3 species)
    not a true protein
  7. 2292111Species Mus musculus [TaxId:10090] [335412] (1 PDB entry)
  8. 2292112Domain d5t0sa_: 5t0s A: [335413]
    automated match to d5ccjb_
    complexed with cd, na

Details for d5t0sa_

PDB Entry: 5t0s (more details), 1.42 Å

PDB Description: synaptotagmin 1 c2b domain, cadmium-bound
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d5t0sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0sa_ b.7.1.2 (A:) automated matches {Mus musculus [TaxId: 10090]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d5t0sa_:

Click to download the PDB-style file with coordinates for d5t0sa_.
(The format of our PDB-style files is described here.)

Timeline for d5t0sa_:

  • d5t0sa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15