SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h0xb1 (5h0x B:11-124)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035041Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2035609Protein automated matches [190376] (1 species)
    not a true protein
  7. 2035610Species Human (Homo sapiens) [TaxId:9606] [187223] (16 PDB entries)
  8. 2292109Domain d5h0xb1: 5h0x B:11-124 [335410]
    Other proteins in same PDB: d5h0xa2, d5h0xb2
    automated match to d5ezpe_

Details for d5h0xb1

PDB Entry: 5h0x (more details), 1.57 Å

PDB Description: crystal structure of h88s mutated human transthyretin
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5h0xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0xb1 b.3.4.1 (B:11-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfsehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d5h0xb1:

Click to download the PDB-style file with coordinates for d5h0xb1.
(The format of our PDB-style files is described here.)

Timeline for d5h0xb1:

  • d5h0xb1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5h0xb2