SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t08d_ (5t08 D:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (11 species)
    trimer
  7. 2238958Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2292108Domain d5t08d_: 5t08 D: [335409]
    Other proteins in same PDB: d5t08a_, d5t08c_, d5t08e_
    automated match to d4kdmb_
    complexed with nag; mutant

Details for d5t08d_

PDB Entry: 5t08 (more details), 2.19 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus
PDB Compounds: (D:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d5t08d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t08d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqkesklnrqgi

SCOPe Domain Coordinates for d5t08d_:

Click to download the PDB-style file with coordinates for d5t08d_.
(The format of our PDB-style files is described here.)

Timeline for d5t08d_:

  • d5t08d_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15