SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l6hd_ (5l6h D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2158220Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2158221Family d.15.1.1: Ubiquitin-related [54237] (39 protein domains)
    Pfam PF00240
  6. 2158454Protein Ubiquitin [54238] (8 species)
  7. 2158457Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (12 PDB entries)
  8. 2292107Domain d5l6hd_: 5l6h D: [335408]
    automated match to d1otrb_
    complexed with 6o2, act, cl, gol, mg, so4

Details for d5l6hd_

PDB Entry: 5l6h (more details), 2.3 Å

PDB Description: uba1 in complex with ub-abpa3 covalent adduct
PDB Compounds: (D:) Ubiquitin-40S ribosomal protein S31

SCOPe Domain Sequences for d5l6hd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6hd_ d.15.1.1 (D:) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5l6hd_:

Click to download the PDB-style file with coordinates for d5l6hd_.
(The format of our PDB-style files is described here.)

Timeline for d5l6hd_:

  • d5l6hd_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15