SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h6vb_ (5h6v B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057706Family b.47.1.3: Viral proteases [50596] (5 protein domains)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 2057796Protein automated matches [190658] (6 species)
    not a true protein
  7. 2281104Species Zika virus (strain mr 766) [TaxId:64320] [324405] (2 PDB entries)
  8. 2292106Domain d5h6vb_: 5h6v B: [335407]
    Other proteins in same PDB: d5h6va_
    automated match to d3e90b_
    complexed with 7hs

Details for d5h6vb_

PDB Entry: 5h6v (more details), 2.42 Å

PDB Description: structure of zika virus protease in complex with a dipeptide inhibitor
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d5h6vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h6vb_ b.47.1.3 (B:) automated matches {Zika virus (strain mr 766) [TaxId: 64320]}
ettdgvyrvmtrkllgstqvgvgvmqegvfhtmwhvtkgaalrsgegrldpywgdvkqdl
vsycgpwkldaawdglsevqllavppgerakniqtlpgifktkdgdigavaldypagtsg
spildkcgrviglygngvvikngsyvsaitqgkre

SCOPe Domain Coordinates for d5h6vb_:

Click to download the PDB-style file with coordinates for d5h6vb_.
(The format of our PDB-style files is described here.)

Timeline for d5h6vb_:

  • d5h6vb_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15