Lineage for d5mr3g_ (5mr3 G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310086Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2310087Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 2310088Family a.19.1.1: Fertilization protein [47083] (3 protein domains)
  6. 2310110Protein automated matches [335347] (1 species)
    not a true protein
  7. 2310111Species Red abalone (Haliotis rufescens) [TaxId:6454] [335348] (5 PDB entries)
  8. 2310117Domain d5mr3g_: 5mr3 G: [335406]
    automated match to d2lisa_
    complexed with cl, gol, nag, pge

Details for d5mr3g_

PDB Entry: 5mr3 (more details), 1.8 Å

PDB Description: crystal structure of red abalone egg verl repeat 2 with linker in complex with sperm lysin at 1.8 a resolution
PDB Compounds: (G:) Egg-lysin

SCOPe Domain Sequences for d5mr3g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mr3g_ a.19.1.1 (G:) automated matches {Red abalone (Haliotis rufescens) [TaxId: 6454]}
vepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwany
mlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmr
padvpvkym

SCOPe Domain Coordinates for d5mr3g_:

Click to download the PDB-style file with coordinates for d5mr3g_.
(The format of our PDB-style files is described here.)

Timeline for d5mr3g_: