SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n1qf_ (5n1q F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177144Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2177239Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2177240Protein automated matches [227074] (4 species)
    not a true protein
  7. 2292100Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335401] (1 PDB entry)
  8. 2292101Domain d5n1qf_: 5n1q F: [335402]
    automated match to d1e6yc_
    complexed with com, f43, gol, k, mg, tp7

Details for d5n1qf_

PDB Entry: 5n1q (more details)

PDB Description: methyl-coenzyme m reductase iii from methanothermococcus thermolithotrophicus at 1.9 a resolution
PDB Compounds: (F:) methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit gamma

SCOPe Domain Sequences for d5n1qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n1qf_ d.58.31.0 (F:) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
aykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpplee
mdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsls
grqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryvy
dektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkri
hrartlggympvnevfdkll

SCOPe Domain Coordinates for d5n1qf_:

Click to download the PDB-style file with coordinates for d5n1qf_.
(The format of our PDB-style files is described here.)

Timeline for d5n1qf_:

  • d5n1qf_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15