Lineage for d5n1qf_ (5n1q F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177144Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2177239Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2177240Protein automated matches [227074] (4 species)
    not a true protein
  7. 2292100Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335401] (1 PDB entry)
  8. 2292101Domain d5n1qf_: 5n1q F: [335402]
    Other proteins in same PDB: d5n1qb2, d5n1qe2
    automated match to d1e6yc_
    complexed with com, f43, gol, k, mg, tp7

Details for d5n1qf_

PDB Entry: 5n1q (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase iii from methanothermococcus thermolithotrophicus at 1.9 a resolution
PDB Compounds: (F:) methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit gamma

SCOPe Domain Sequences for d5n1qf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n1qf_ d.58.31.0 (F:) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
aykpqfypgatkiaqnrrdhlnpdfeleklreipdeelvkvmghrqpgedyktvhpplee
mdlpedyvrdlvepisgakeghriryiqfadsmyfapaqpydrarmymwrfrgvdtgsls
grqviemresnleeisknvlmdtslfdparigmrgatvhghslrldenglmfdalqryvy
dektghvvyvkdqvgrpldepvdvgeplpeeklreittiyrkdgvpmrddeelltvvkri
hrartlggympvnevfdkll

SCOPe Domain Coordinates for d5n1qf_:

Click to download the PDB-style file with coordinates for d5n1qf_.
(The format of our PDB-style files is described here.)

Timeline for d5n1qf_:

  • d5n1qf_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15