Lineage for d5t3oa1 (5t3o A:4-160)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2292094Species Thermus thermophilus [TaxId:274] [335395] (1 PDB entry)
  8. 2292095Domain d5t3oa1: 5t3o A:4-160 [335396]
    automated match to d2ji4a1
    complexed with adp, so4

Details for d5t3oa1

PDB Entry: 5t3o (more details), 2.2 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5t3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3oa1 c.61.1.0 (A:4-160) automated matches {Thermus thermophilus [TaxId: 274]}
pllifsgqsnrplaqaiaealglplgksttlrfandnlfvryeeslregdvfivqsfvpp
vqdhlmellmmvdaakgasaarvtavipyfsyarsdkkdaprisitarliadllqtagad
rvltmtlhspqvhgffkipvdhlsaepvianyfatrv

SCOPe Domain Coordinates for d5t3oa1:

Click to download the PDB-style file with coordinates for d5t3oa1.
(The format of our PDB-style files is described here.)

Timeline for d5t3oa1:

  • d5t3oa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15