SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t3oa1 (5t3o A:4-160)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2292094Species Thermus thermophilus [TaxId:274] [335395] (1 PDB entry)
  8. 2292095Domain d5t3oa1: 5t3o A:4-160 [335396]
    automated match to d2ji4a1
    complexed with adp, so4

Details for d5t3oa1

PDB Entry: 5t3o (more details), 2.2 Å

PDB Description: crystal structure of the phosphorybosylpyrophosphate synthetase ii from thermus thermophilus
PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d5t3oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t3oa1 c.61.1.0 (A:4-160) automated matches {Thermus thermophilus [TaxId: 274]}
pllifsgqsnrplaqaiaealglplgksttlrfandnlfvryeeslregdvfivqsfvpp
vqdhlmellmmvdaakgasaarvtavipyfsyarsdkkdaprisitarliadllqtagad
rvltmtlhspqvhgffkipvdhlsaepvianyfatrv

SCOPe Domain Coordinates for d5t3oa1:

Click to download the PDB-style file with coordinates for d5t3oa1.
(The format of our PDB-style files is described here.)

Timeline for d5t3oa1:

  • d5t3oa1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15