Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
Protein automated matches [227074] (6 species) not a true protein |
Species Methanotorris formicicus [TaxId:647171] [335373] (2 PDB entries) |
Domain d5n2ac_: 5n2a C: [335393] Other proteins in same PDB: d5n2ab2 automated match to d1e6yc_ complexed with br, com, f43, k, tp7 |
PDB Entry: 5n2a (more details), 2.8 Å
SCOPe Domain Sequences for d5n2ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n2ac_ d.58.31.0 (C:) automated matches {Methanotorris formicicus [TaxId: 647171]} ykpqfypgetkiaqnrrnhmnpeveleklreipdedvvkimghrqpgedyktihppleem dlpddyvrdlvepingakeghriryiqfadsmyfapaqpydrartymwrfrgvdtgtlsg rqviemresdlealsknflidtaffdparcgirgatvhghslrldenglmfdalqryvyd ektghvvyvkdqvgrpldepvdvgellpeeklreittiyrkdgvpmredkelltivkrih rartlggfcptedtfkql
Timeline for d5n2ac_: