SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n4gl1 (5n4g L:1-111)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2292089Domain d5n4gl1: 5n4g L:1-111 [335390]
    Other proteins in same PDB: d5n4gl2
    automated match to d1dn0a1
    complexed with edo, so4

Details for d5n4gl1

PDB Entry: 5n4g (more details), 2.75 Å

PDB Description: human fab fragment 12e1 against nhba from neisseria meningitidis
PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d5n4gl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n4gl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqsplslpvtlgqpasiscrssqdlvyrdgitylnwfqqrpgqsprrliykvsnrd
sgvpdrfsgsgsgtdftlrisrveaedigvyycmqgthwpitfgqgtrlei

SCOPe Domain Coordinates for d5n4gl1:

Click to download the PDB-style file with coordinates for d5n4gl1.
(The format of our PDB-style files is described here.)

Timeline for d5n4gl1:

  • d5n4gl1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15