SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iiac_ (5iia C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986373Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986374Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 1986375Family a.19.1.1: Fertilization protein [47083] (3 protein domains)
  6. 1986376Protein Lysin [47084] (2 species)
  7. 1986380Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries)
  8. 2292088Domain d5iiac_: 5iia C: [335389]
    automated match to d2lisa_
    complexed with nag

Details for d5iiac_

PDB Entry: 5iia (more details), 1.7 Å

PDB Description: crystal structure of red abalone egg verl repeat 3 in complex with sperm lysin at 1.7 a resolution (crystal form i)
PDB Compounds: (C:) Egg-lysin

SCOPe Domain Sequences for d5iiac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iiac_ a.19.1.1 (C:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}
flnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlwi
nkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpadv
pvkym

SCOPe Domain Coordinates for d5iiac_:

Click to download the PDB-style file with coordinates for d5iiac_.
(The format of our PDB-style files is described here.)

Timeline for d5iiac_:

  • d5iiac_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15