SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ii7a_ (5ii7 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986373Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986374Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 1986375Family a.19.1.1: Fertilization protein [47083] (3 protein domains)
  6. 2292046Protein automated matches [335347] (1 species)
    not a true protein
  7. 2292047Species Haliotis rufescens [TaxId:6454] [335348] (4 PDB entries)
  8. 2292085Domain d5ii7a_: 5ii7 A: [335386]
    automated match to d2lisa_
    complexed with mes, so4

Details for d5ii7a_

PDB Entry: 5ii7 (more details), 1.66 Å

PDB Description: in-house sulfur-sad structure of orthorhombic red abalone lysin at 1.66 a resolution
PDB Compounds: (A:) Egg-lysin

SCOPe Domain Sequences for d5ii7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ii7a_ a.19.1.1 (A:) automated matches {Haliotis rufescens [TaxId: 6454]}
whyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthw
anymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeein
rmrpadvpvkym

SCOPe Domain Coordinates for d5ii7a_:

Click to download the PDB-style file with coordinates for d5ii7a_.
(The format of our PDB-style files is described here.)

Timeline for d5ii7a_:

  • d5ii7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15