SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iuea2 (5iue A:182-276)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2026747Species Human (Homo sapiens) [TaxId:9606] [187920] (847 PDB entries)
  8. 2292077Domain d5iuea2: 5iue A:182-276 [335378]
    Other proteins in same PDB: d5iuea1, d5iueb_, d5iuee1, d5iuef_, d5iueg1, d5iueh_
    automated match to d1efxa1
    complexed with nag

Details for d5iuea2

PDB Entry: 5iue (more details), 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors
PDB Compounds: (A:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iuea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iuea2 b.1.1.0 (A:182-276) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adppkahvahhpisdheatlrcwalgfypaeitltwqrdgeeqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpqplilrweq

SCOPe Domain Coordinates for d5iuea2:

Click to download the PDB-style file with coordinates for d5iuea2.
(The format of our PDB-style files is described here.)

Timeline for d5iuea2:

  • d5iuea2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15