SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jxxa_ (5jxx A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2069505Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2069506Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2069791Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2069792Protein automated matches [190967] (30 species)
    not a true protein
  7. 2292069Species Moraxella catarrhalis [TaxId:1236608] [335370] (1 PDB entry)
  8. 2292070Domain d5jxxa_: 5jxx A: [335371]
    automated match to d4e6ua_
    complexed with flc, gol

Details for d5jxxa_

PDB Entry: 5jxx (more details), 3 Å

PDB Description: crystal structure of udp-n-acetylglucosamine o-acyltransferase (lpxa) from moraxella catarrhalis rh4.
PDB Compounds: (A:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5jxxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jxxa_ b.81.1.0 (A:) automated matches {Moraxella catarrhalis [TaxId: 1236608]}
mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
iqllidsinnskrglvr

SCOPe Domain Coordinates for d5jxxa_:

Click to download the PDB-style file with coordinates for d5jxxa_.
(The format of our PDB-style files is described here.)

Timeline for d5jxxa_:

  • d5jxxa_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15