Lineage for d5ii8a_ (5ii8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1986373Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1986374Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 1986375Family a.19.1.1: Fertilization protein [47083] (3 protein domains)
  6. 2292046Protein automated matches [335347] (1 species)
    not a true protein
  7. 2292047Species Haliotis rufescens [TaxId:6454] [335348] (4 PDB entries)
  8. 2292067Domain d5ii8a_: 5ii8 A: [335368]
    automated match to d2lisa_
    complexed with mes, so4

Details for d5ii8a_

PDB Entry: 5ii8 (more details), 0.99 Å

PDB Description: orthorhombic crystal structure of red abalone lysin at 0.99 a resolution
PDB Compounds: (A:) Egg-lysin

SCOPe Domain Sequences for d5ii8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ii8a_ a.19.1.1 (A:) automated matches {Haliotis rufescens [TaxId: 6454]}
hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
mrpadvpvkym

SCOPe Domain Coordinates for d5ii8a_:

Click to download the PDB-style file with coordinates for d5ii8a_.
(The format of our PDB-style files is described here.)

Timeline for d5ii8a_:

  • d5ii8a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-15